Icon representing a puzzle

2489: Revisiting Puzzle 67: Integrase

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,567
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,514
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,428
  4. Avatar for Contenders 4. Contenders 33 pts. 10,417
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,391
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,379
  7. Avatar for Team China 7. Team China 8 pts. 10,288
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 10,283
  9. Avatar for Australia 9. Australia 3 pts. 10,241
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 2 pts. 10,233
  1. Avatar for Merf 51. Merf Lv 1 1 pt. 9,727
  2. Avatar for carxo 52. carxo Lv 1 1 pt. 9,716
  3. Avatar for alyssa_d_V2.0 53. alyssa_d_V2.0 Lv 1 1 pt. 9,653
  4. Avatar for jawz101 54. jawz101 Lv 1 1 pt. 9,628
  5. Avatar for wosser1 55. wosser1 Lv 1 1 pt. 9,591
  6. Avatar for Deleted player 56. Deleted player 1 pt. 9,496
  7. Avatar for mengzach 57. mengzach Lv 1 1 pt. 9,485
  8. Avatar for wudooAI 58. wudooAI Lv 1 1 pt. 9,481
  9. Avatar for WuWTq 59. WuWTq Lv 1 1 pt. 9,449
  10. Avatar for frostschutz 60. frostschutz Lv 1 1 pt. 9,440

Comments