Placeholder image of a protein
Icon representing a puzzle

2514: Refine Density Reconstruction 8

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
September 19, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2237, which was Reconstruction Puzzle 19, but now we have the Refine Density tool available to make folds even better!

Sequence
MLPPLPDFSLSVEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS

Top groups


  1. Avatar for Go Science 100 pts. 25,059
  2. Avatar for Contenders 2. Contenders 68 pts. 24,682
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 24,248
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 23,898
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 23,661
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 23,414
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 22,877
  8. Avatar for VeFold 8. VeFold 3 pts. 22,677
  9. Avatar for Australia 9. Australia 1 pt. 22,535
  10. Avatar for Russian team 10. Russian team 1 pt. 22,407

  1. Avatar for Sammy3c2b1a0 61. Sammy3c2b1a0 Lv 1 1 pt. 15,369
  2. Avatar for selimamangeldiyev 62. selimamangeldiyev Lv 1 1 pt. 14,267
  3. Avatar for cheesetheboss 63. cheesetheboss Lv 1 1 pt. 13,341
  4. Avatar for Dmytrylysozyme 64. Dmytrylysozyme Lv 1 1 pt. 3,039
  5. Avatar for zqiaj 65. zqiaj Lv 1 1 pt. 0
  6. Avatar for toshiue 66. toshiue Lv 1 1 pt. 0
  7. Avatar for orily1337 67. orily1337 Lv 1 1 pt. 0
  8. Avatar for mlay2026 68. mlay2026 Lv 1 1 pt. 0

Comments