Icon representing a puzzle

2513: Revisiting Puzzle 73: Polycystein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
September 25, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 9,243
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 9,235
  3. Avatar for Beta Folders 13. Beta Folders 1 pt. 8,529
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 8,161
  1. Avatar for Dr.Sillem 21. Dr.Sillem Lv 1 20 pts. 10,101
  2. Avatar for BarrySampson 22. BarrySampson Lv 1 18 pts. 10,090
  3. Avatar for alcor29 23. alcor29 Lv 1 16 pts. 10,040
  4. Avatar for pizpot 24. pizpot Lv 1 15 pts. 10,023
  5. Avatar for ProfVince 25. ProfVince Lv 1 13 pts. 10,010
  6. Avatar for ppp6 26. ppp6 Lv 1 12 pts. 10,005
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 11 pts. 9,966
  8. Avatar for AlphaFold2 28. AlphaFold2 Lv 1 10 pts. 9,962
  9. Avatar for rosie4loop 29. rosie4loop Lv 1 9 pts. 9,911
  10. Avatar for roarshock 30. roarshock Lv 1 8 pts. 9,854

Comments