Icon representing a puzzle

2513: Revisiting Puzzle 73: Polycystein

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
September 25, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,746
  2. Avatar for Go Science 2. Go Science 68 pts. 10,677
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,571
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,484
  5. Avatar for Contenders 5. Contenders 16 pts. 10,481
  6. Avatar for Australia 6. Australia 9 pts. 10,429
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 10,371
  8. Avatar for VeFold 8. VeFold 3 pts. 10,101
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,966
  10. Avatar for Russian team 10. Russian team 1 pt. 9,599

  1. Avatar for Dr.Sillem 21. Dr.Sillem Lv 1 20 pts. 10,101
  2. Avatar for BarrySampson 22. BarrySampson Lv 1 18 pts. 10,090
  3. Avatar for alcor29 23. alcor29 Lv 1 16 pts. 10,040
  4. Avatar for pizpot 24. pizpot Lv 1 15 pts. 10,023
  5. Avatar for ProfVince 25. ProfVince Lv 1 13 pts. 10,010
  6. Avatar for ppp6 26. ppp6 Lv 1 12 pts. 10,005
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 11 pts. 9,966
  8. Avatar for AlphaFold2 28. AlphaFold2 Lv 1 10 pts. 9,962
  9. Avatar for rosie4loop 29. rosie4loop Lv 1 9 pts. 9,911
  10. Avatar for roarshock 30. roarshock Lv 1 8 pts. 9,854

Comments