Placeholder image of a protein
Icon representing a puzzle

2520: Refine Density Reconstruction 9

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
October 03, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2326, which was Reconstruction Puzzle 48, but now we have the Refine Density tool available to make folds even better! This puzzle has four chains in it, two of each type. Two have the sequence GIVEQCCTSICSLYQLENYCN and two have the sequence FVNQHLCGEHLVEALYLVCGERGFFYTPKT.

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 14,751
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 13,739

  1. Avatar for zanbato 21. zanbato Lv 1 19 pts. 15,018
  2. Avatar for WBarme1234 22. WBarme1234 Lv 1 17 pts. 15,000
  3. Avatar for alcor29 23. alcor29 Lv 1 15 pts. 14,934
  4. Avatar for akaaka 24. akaaka Lv 1 14 pts. 14,918
  5. Avatar for BarrySampson 25. BarrySampson Lv 1 12 pts. 14,902
  6. Avatar for drumpeter18yrs9yrs 26. drumpeter18yrs9yrs Lv 1 11 pts. 14,889
  7. Avatar for dcrwheeler 27. dcrwheeler Lv 1 10 pts. 14,887
  8. Avatar for rinze 28. rinze Lv 1 9 pts. 14,879
  9. Avatar for rosie4loop 29. rosie4loop Lv 1 8 pts. 14,873
  10. Avatar for Hellcat6 30. Hellcat6 Lv 1 7 pts. 14,864

Comments