Placeholder image of a protein
Icon representing a puzzle

2520: Refine Density Reconstruction 9

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
October 03, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2326, which was Reconstruction Puzzle 48, but now we have the Refine Density tool available to make folds even better! This puzzle has four chains in it, two of each type. Two have the sequence GIVEQCCTSICSLYQLENYCN and two have the sequence FVNQHLCGEHLVEALYLVCGERGFFYTPKT.

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 14,751
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 13,739

  1. Avatar for abiogenesis 41. abiogenesis Lv 1 2 pts. 14,490
  2. Avatar for EIIisTAB2 42. EIIisTAB2 Lv 1 2 pts. 14,418
  3. Avatar for RWoodcock 43. RWoodcock Lv 1 1 pt. 14,386
  4. Avatar for carxo 44. carxo Lv 1 1 pt. 14,368
  5. Avatar for jamiexq 45. jamiexq Lv 1 1 pt. 14,316
  6. Avatar for nicobul 46. nicobul Lv 1 1 pt. 14,297
  7. Avatar for roarshock 47. roarshock Lv 1 1 pt. 14,295
  8. Avatar for Steven Pletsch 48. Steven Pletsch Lv 1 1 pt. 14,270
  9. Avatar for Dr.Sillem 49. Dr.Sillem Lv 1 1 pt. 14,239
  10. Avatar for maithra 50. maithra Lv 1 1 pt. 14,208

Comments