Icon representing a puzzle

2519: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 09, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,187
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 10,175
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 10,137
  4. Avatar for Contenders 4. Contenders 24 pts. 10,092
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 10,080
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 10,055
  7. Avatar for Australia 7. Australia 4 pts. 10,031
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 10,026
  9. Avatar for VeFold 9. VeFold 1 pt. 9,970
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 1 pt. 9,910
  1. Avatar for MsHsi 71. MsHsi Lv 1 1 pt. 9,181
  2. Avatar for Sammy3c2b1a0 72. Sammy3c2b1a0 Lv 1 1 pt. 9,140
  3. Avatar for furi0us 73. furi0us Lv 1 1 pt. 9,098
  4. Avatar for Kh.Rustamov 74. Kh.Rustamov Lv 1 1 pt. 9,002
  5. Avatar for Nellybee9 75. Nellybee9 Lv 1 1 pt. 8,916
  6. Avatar for baconcheese113 76. baconcheese113 Lv 1 1 pt. 8,752
  7. Avatar for oitiniba 77. oitiniba Lv 1 1 pt. 8,744
  8. Avatar for tongych3 78. tongych3 Lv 1 1 pt. 8,733
  9. Avatar for Neil0615 79. Neil0615 Lv 1 1 pt. 8,625
  10. Avatar for JellyfishOliPlays 80. JellyfishOliPlays Lv 1 1 pt. 8,579

Comments