Placeholder image of a protein
Icon representing a puzzle

2523: Refine Density Reconstruction 10

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
October 16, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2374, which was Reconstruction Puzzle 64, but now we have the Refine Density tool available to make folds even better!There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 18,695
  2. Avatar for I-14 Salt Bridges 12. I-14 Salt Bridges 1 pt. 18,589
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 18,566
  1. Avatar for akaaka 11. akaaka Lv 1 46 pts. 19,496
  2. Avatar for Galaxie 12. Galaxie Lv 1 42 pts. 19,467
  3. Avatar for gmn 13. gmn Lv 1 39 pts. 19,425
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 36 pts. 19,389
  5. Avatar for TheGUmmer 15. TheGUmmer Lv 1 33 pts. 19,374
  6. Avatar for manu8170 16. manu8170 Lv 1 30 pts. 19,353
  7. Avatar for abiogenesis 17. abiogenesis Lv 1 27 pts. 19,343
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 25 pts. 19,306
  9. Avatar for AlkiP0Ps 19. AlkiP0Ps Lv 1 23 pts. 19,302
  10. Avatar for BarrySampson 20. BarrySampson Lv 1 20 pts. 19,300

Comments