Placeholder image of a protein
Icon representing a puzzle

2523: Refine Density Reconstruction 10

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
October 16, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2374, which was Reconstruction Puzzle 64, but now we have the Refine Density tool available to make folds even better!There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 20,136
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 19,668
  3. Avatar for Contenders 3. Contenders 41 pts. 19,621
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 19,522
  5. Avatar for Void Crushers 5. Void Crushers 14 pts. 19,374
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 19,306
  7. Avatar for Australia 7. Australia 4 pts. 19,302
  8. Avatar for VeFold 8. VeFold 2 pts. 19,300
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 19,115
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 1 pt. 18,853
  1. Avatar for akaaka 11. akaaka Lv 1 46 pts. 19,496
  2. Avatar for Galaxie 12. Galaxie Lv 1 42 pts. 19,467
  3. Avatar for gmn 13. gmn Lv 1 39 pts. 19,425
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 36 pts. 19,389
  5. Avatar for TheGUmmer 15. TheGUmmer Lv 1 33 pts. 19,374
  6. Avatar for manu8170 16. manu8170 Lv 1 30 pts. 19,353
  7. Avatar for abiogenesis 17. abiogenesis Lv 1 27 pts. 19,343
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 25 pts. 19,306
  9. Avatar for AlkiP0Ps 19. AlkiP0Ps Lv 1 23 pts. 19,302
  10. Avatar for BarrySampson 20. BarrySampson Lv 1 20 pts. 19,300

Comments