Placeholder image of a protein
Icon representing a puzzle

2523: Refine Density Reconstruction 10

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
October 16, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2374, which was Reconstruction Puzzle 64, but now we have the Refine Density tool available to make folds even better!There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 18,695
  2. Avatar for I-14 Salt Bridges 12. I-14 Salt Bridges 1 pt. 18,589
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 18,566
  1. Avatar for grogar7 21. grogar7 Lv 1 19 pts. 19,299
  2. Avatar for latin krepin 22. latin krepin Lv 1 17 pts. 19,294
  3. Avatar for drumpeter18yrs9yrs 23. drumpeter18yrs9yrs Lv 1 15 pts. 19,289
  4. Avatar for dcrwheeler 24. dcrwheeler Lv 1 14 pts. 19,278
  5. Avatar for alcor29 25. alcor29 Lv 1 12 pts. 19,274
  6. Avatar for g_b 26. g_b Lv 1 11 pts. 19,268
  7. Avatar for zbp 27. zbp Lv 1 10 pts. 19,237
  8. Avatar for Crossed Sticks 28. Crossed Sticks Lv 1 9 pts. 19,234
  9. Avatar for Th1sN@me!sN0tAPun 29. Th1sN@me!sN0tAPun Lv 1 8 pts. 19,195
  10. Avatar for rosie4loop 30. rosie4loop Lv 1 7 pts. 19,123

Comments