Placeholder image of a protein
Icon representing a puzzle

2523: Refine Density Reconstruction 10

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
October 16, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2374, which was Reconstruction Puzzle 64, but now we have the Refine Density tool available to make folds even better!There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 20,136
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 19,668
  3. Avatar for Contenders 3. Contenders 41 pts. 19,621
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 19,522
  5. Avatar for Void Crushers 5. Void Crushers 14 pts. 19,374
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 19,306
  7. Avatar for Australia 7. Australia 4 pts. 19,302
  8. Avatar for VeFold 8. VeFold 2 pts. 19,300
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 19,115
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 1 pt. 18,853
  1. Avatar for grogar7 21. grogar7 Lv 1 19 pts. 19,299
  2. Avatar for latin krepin 22. latin krepin Lv 1 17 pts. 19,294
  3. Avatar for drumpeter18yrs9yrs 23. drumpeter18yrs9yrs Lv 1 15 pts. 19,289
  4. Avatar for dcrwheeler 24. dcrwheeler Lv 1 14 pts. 19,278
  5. Avatar for alcor29 25. alcor29 Lv 1 12 pts. 19,274
  6. Avatar for g_b 26. g_b Lv 1 11 pts. 19,268
  7. Avatar for zbp 27. zbp Lv 1 10 pts. 19,237
  8. Avatar for Crossed Sticks 28. Crossed Sticks Lv 1 9 pts. 19,234
  9. Avatar for Th1sN@me!sN0tAPun 29. Th1sN@me!sN0tAPun Lv 1 8 pts. 19,195
  10. Avatar for rosie4loop 30. rosie4loop Lv 1 7 pts. 19,123

Comments