Placeholder image of a protein
Icon representing a puzzle

2523: Refine Density Reconstruction 10

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
October 16, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2374, which was Reconstruction Puzzle 64, but now we have the Refine Density tool available to make folds even better!There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 18,695
  2. Avatar for I-14 Salt Bridges 12. I-14 Salt Bridges 1 pt. 18,589
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 18,566
  1. Avatar for fpc 31. fpc Lv 1 6 pts. 19,115
  2. Avatar for ProfVince 32. ProfVince Lv 1 6 pts. 19,086
  3. Avatar for JuliaBCollet 33. JuliaBCollet Lv 1 5 pts. 19,008
  4. Avatar for meatexplosion 34. meatexplosion Lv 1 4 pts. 18,912
  5. Avatar for Trajan464 35. Trajan464 Lv 1 4 pts. 18,899
  6. Avatar for zanbato 36. zanbato Lv 1 3 pts. 18,853
  7. Avatar for Anfinsen_slept_here 37. Anfinsen_slept_here Lv 1 3 pts. 18,773
  8. Avatar for carxo 38. carxo Lv 1 3 pts. 18,773
  9. Avatar for Hellcat6 39. Hellcat6 Lv 1 2 pts. 18,736
  10. Avatar for alyssa_d_V2.0 40. alyssa_d_V2.0 Lv 1 2 pts. 18,695

Comments