Placeholder image of a protein
Icon representing a puzzle

2523: Refine Density Reconstruction 10

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
October 16, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2374, which was Reconstruction Puzzle 64, but now we have the Refine Density tool available to make folds even better!There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups


  1. Avatar for Go Science 100 pts. 20,136
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 19,668
  3. Avatar for Contenders 3. Contenders 41 pts. 19,621
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 19,522
  5. Avatar for Void Crushers 5. Void Crushers 14 pts. 19,374
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 19,306
  7. Avatar for Australia 7. Australia 4 pts. 19,302
  8. Avatar for VeFold 8. VeFold 2 pts. 19,300
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 19,115
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 1 pt. 18,853

  1. Avatar for fpc 31. fpc Lv 1 6 pts. 19,115
  2. Avatar for ProfVince 32. ProfVince Lv 1 6 pts. 19,086
  3. Avatar for JuliaBCollet 33. JuliaBCollet Lv 1 5 pts. 19,008
  4. Avatar for meatexplosion 34. meatexplosion Lv 1 4 pts. 18,912
  5. Avatar for Trajan464 35. Trajan464 Lv 1 4 pts. 18,899
  6. Avatar for zanbato 36. zanbato Lv 1 3 pts. 18,853
  7. Avatar for Anfinsen_slept_here 37. Anfinsen_slept_here Lv 1 3 pts. 18,773
  8. Avatar for carxo 38. carxo Lv 1 3 pts. 18,773
  9. Avatar for Hellcat6 39. Hellcat6 Lv 1 2 pts. 18,736
  10. Avatar for alyssa_d_V2.0 40. alyssa_d_V2.0 Lv 1 2 pts. 18,695

Comments