Placeholder image of a protein
Icon representing a puzzle

2523: Refine Density Reconstruction 10

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
October 16, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2374, which was Reconstruction Puzzle 64, but now we have the Refine Density tool available to make folds even better!There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 18,695
  2. Avatar for I-14 Salt Bridges 12. I-14 Salt Bridges 1 pt. 18,589
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 18,566
  1. Avatar for ppp6 41. ppp6 Lv 1 2 pts. 18,653
  2. Avatar for rinze 42. rinze Lv 1 2 pts. 18,624
  3. Avatar for lancetime 43. lancetime Lv 1 1 pt. 18,589
  4. Avatar for Kyrylo 44. Kyrylo Lv 1 1 pt. 18,566
  5. Avatar for maithra 45. maithra Lv 1 1 pt. 18,484
  6. Avatar for nicobul 46. nicobul Lv 1 1 pt. 18,483
  7. Avatar for roarshock 47. roarshock Lv 1 1 pt. 18,476
  8. Avatar for Dr.Sillem 48. Dr.Sillem Lv 1 1 pt. 18,451
  9. Avatar for Mohoernchen 49. Mohoernchen Lv 1 1 pt. 18,406
  10. Avatar for Idiotboy 50. Idiotboy Lv 1 1 pt. 18,403

Comments