Placeholder image of a protein
Icon representing a puzzle

2523: Refine Density Reconstruction 10

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
October 16, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2374, which was Reconstruction Puzzle 64, but now we have the Refine Density tool available to make folds even better!There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups


  1. Avatar for Go Science 100 pts. 20,136
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 19,668
  3. Avatar for Contenders 3. Contenders 41 pts. 19,621
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 19,522
  5. Avatar for Void Crushers 5. Void Crushers 14 pts. 19,374
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 19,306
  7. Avatar for Australia 7. Australia 4 pts. 19,302
  8. Avatar for VeFold 8. VeFold 2 pts. 19,300
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 19,115
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 1 pt. 18,853

  1. Avatar for ppp6 41. ppp6 Lv 1 2 pts. 18,653
  2. Avatar for rinze 42. rinze Lv 1 2 pts. 18,624
  3. Avatar for lancetime 43. lancetime Lv 1 1 pt. 18,589
  4. Avatar for Kyrylo 44. Kyrylo Lv 1 1 pt. 18,566
  5. Avatar for maithra 45. maithra Lv 1 1 pt. 18,484
  6. Avatar for nicobul 46. nicobul Lv 1 1 pt. 18,483
  7. Avatar for roarshock 47. roarshock Lv 1 1 pt. 18,476
  8. Avatar for Dr.Sillem 48. Dr.Sillem Lv 1 1 pt. 18,451
  9. Avatar for Mohoernchen 49. Mohoernchen Lv 1 1 pt. 18,406
  10. Avatar for Idiotboy 50. Idiotboy Lv 1 1 pt. 18,403

Comments