Placeholder image of a protein
Icon representing a puzzle

2523: Refine Density Reconstruction 10

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
October 16, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2374, which was Reconstruction Puzzle 64, but now we have the Refine Density tool available to make folds even better!There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 18,695
  2. Avatar for I-14 Salt Bridges 12. I-14 Salt Bridges 1 pt. 18,589
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 18,566
  1. Avatar for jamiexq 51. jamiexq Lv 1 1 pt. 18,346
  2. Avatar for pfirth 52. pfirth Lv 1 1 pt. 18,155
  3. Avatar for The Cleric 53. The Cleric Lv 1 1 pt. 18,100
  4. Avatar for Merf 54. Merf Lv 1 1 pt. 18,057
  5. Avatar for jausmh 55. jausmh Lv 1 1 pt. 18,032
  6. Avatar for muffnerk 56. muffnerk Lv 1 1 pt. 17,977
  7. Avatar for RWoodcock 57. RWoodcock Lv 1 1 pt. 17,960
  8. Avatar for vctrchch 58. vctrchch Lv 1 1 pt. 17,903
  9. Avatar for DScott 59. DScott Lv 1 1 pt. 17,884
  10. Avatar for drjr 60. drjr Lv 1 1 pt. 17,864

Comments