Placeholder image of a protein
Icon representing a puzzle

2523: Refine Density Reconstruction 10

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
October 16, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2374, which was Reconstruction Puzzle 64, but now we have the Refine Density tool available to make folds even better!There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 20,136
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 19,668
  3. Avatar for Contenders 3. Contenders 41 pts. 19,621
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 19,522
  5. Avatar for Void Crushers 5. Void Crushers 14 pts. 19,374
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 19,306
  7. Avatar for Australia 7. Australia 4 pts. 19,302
  8. Avatar for VeFold 8. VeFold 2 pts. 19,300
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 19,115
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 1 pt. 18,853
  1. Avatar for jamiexq 51. jamiexq Lv 1 1 pt. 18,346
  2. Avatar for pfirth 52. pfirth Lv 1 1 pt. 18,155
  3. Avatar for The Cleric 53. The Cleric Lv 1 1 pt. 18,100
  4. Avatar for Merf 54. Merf Lv 1 1 pt. 18,057
  5. Avatar for jausmh 55. jausmh Lv 1 1 pt. 18,032
  6. Avatar for muffnerk 56. muffnerk Lv 1 1 pt. 17,977
  7. Avatar for RWoodcock 57. RWoodcock Lv 1 1 pt. 17,960
  8. Avatar for vctrchch 58. vctrchch Lv 1 1 pt. 17,903
  9. Avatar for DScott 59. DScott Lv 1 1 pt. 17,884
  10. Avatar for drjr 60. drjr Lv 1 1 pt. 17,864

Comments