Placeholder image of a protein
Icon representing a puzzle

2548: Refine Density Reconstruction 17

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 11, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2261, which was Reconstruction Puzzle 26, but now we have the Refine Density tool available to make folds even better! his puzzle has a couple copies of two proteins as well as peptides bound.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 22,160
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 19,983
  3. Avatar for incognito group 13. incognito group 1 pt. 12,844
  4. Avatar for Gargleblasters 14. Gargleblasters 1 pt. 12,844
  1. Avatar for gmn 11. gmn Lv 1 47 pts. 23,026
  2. Avatar for meatexplosion 12. meatexplosion Lv 1 43 pts. 23,023
  3. Avatar for pizpot 13. pizpot Lv 1 40 pts. 23,010
  4. Avatar for WBarme1234 14. WBarme1234 Lv 1 36 pts. 22,995
  5. Avatar for Trajan464 15. Trajan464 Lv 1 33 pts. 22,971
  6. Avatar for Gerom 16. Gerom Lv 1 30 pts. 22,959
  7. Avatar for Crossed Sticks 17. Crossed Sticks Lv 1 28 pts. 22,957
  8. Avatar for Galaxie 18. Galaxie Lv 1 25 pts. 22,933
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 23 pts. 22,926
  10. Avatar for grogar7 20. grogar7 Lv 1 21 pts. 22,885

Comments