Placeholder image of a protein
Icon representing a puzzle

2548: Refine Density Reconstruction 17

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 11, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2261, which was Reconstruction Puzzle 26, but now we have the Refine Density tool available to make folds even better! his puzzle has a couple copies of two proteins as well as peptides bound.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 23,923
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 23,688
  3. Avatar for Australia 3. Australia 44 pts. 23,337
  4. Avatar for Contenders 4. Contenders 27 pts. 23,324
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 23,307
  6. Avatar for VeFold 6. VeFold 9 pts. 23,129
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 22,995
  8. Avatar for Russian team 8. Russian team 3 pts. 22,959
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 22,844
  10. Avatar for Team China 10. Team China 1 pt. 22,242
  1. Avatar for gmn 11. gmn Lv 1 47 pts. 23,026
  2. Avatar for meatexplosion 12. meatexplosion Lv 1 43 pts. 23,023
  3. Avatar for pizpot 13. pizpot Lv 1 40 pts. 23,010
  4. Avatar for WBarme1234 14. WBarme1234 Lv 1 36 pts. 22,995
  5. Avatar for Trajan464 15. Trajan464 Lv 1 33 pts. 22,971
  6. Avatar for Gerom 16. Gerom Lv 1 30 pts. 22,959
  7. Avatar for Crossed Sticks 17. Crossed Sticks Lv 1 28 pts. 22,957
  8. Avatar for Galaxie 18. Galaxie Lv 1 25 pts. 22,933
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 23 pts. 22,926
  10. Avatar for grogar7 20. grogar7 Lv 1 21 pts. 22,885

Comments