Placeholder image of a protein
Icon representing a puzzle

2548: Refine Density Reconstruction 17

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 11, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2261, which was Reconstruction Puzzle 26, but now we have the Refine Density tool available to make folds even better! his puzzle has a couple copies of two proteins as well as peptides bound.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 22,160
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 19,983
  3. Avatar for incognito group 13. incognito group 1 pt. 12,844
  4. Avatar for Gargleblasters 14. Gargleblasters 1 pt. 12,844
  1. Avatar for Vinara 41. Vinara Lv 1 2 pts. 22,127
  2. Avatar for RWoodcock 42. RWoodcock Lv 1 2 pts. 22,110
  3. Avatar for nicobul 43. nicobul Lv 1 2 pts. 22,088
  4. Avatar for Swapper242 44. Swapper242 Lv 1 1 pt. 22,086
  5. Avatar for Dr.Sillem 45. Dr.Sillem Lv 1 1 pt. 22,083
  6. Avatar for carxo 46. carxo Lv 1 1 pt. 22,070
  7. Avatar for carsonfb 47. carsonfb Lv 1 1 pt. 21,977
  8. Avatar for Hexafluorouranate 48. Hexafluorouranate Lv 1 1 pt. 21,887
  9. Avatar for rinze 49. rinze Lv 1 1 pt. 21,870
  10. Avatar for jamiexq 50. jamiexq Lv 1 1 pt. 21,864

Comments