Placeholder image of a protein
Icon representing a puzzle

2548: Refine Density Reconstruction 17

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 11, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2261, which was Reconstruction Puzzle 26, but now we have the Refine Density tool available to make folds even better! his puzzle has a couple copies of two proteins as well as peptides bound.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 23,923
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 23,688
  3. Avatar for Australia 3. Australia 44 pts. 23,337
  4. Avatar for Contenders 4. Contenders 27 pts. 23,324
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 23,307
  6. Avatar for VeFold 6. VeFold 9 pts. 23,129
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 22,995
  8. Avatar for Russian team 8. Russian team 3 pts. 22,959
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 22,844
  10. Avatar for Team China 10. Team China 1 pt. 22,242
  1. Avatar for Vinara 41. Vinara Lv 1 2 pts. 22,127
  2. Avatar for RWoodcock 42. RWoodcock Lv 1 2 pts. 22,110
  3. Avatar for nicobul 43. nicobul Lv 1 2 pts. 22,088
  4. Avatar for Swapper242 44. Swapper242 Lv 1 1 pt. 22,086
  5. Avatar for Dr.Sillem 45. Dr.Sillem Lv 1 1 pt. 22,083
  6. Avatar for carxo 46. carxo Lv 1 1 pt. 22,070
  7. Avatar for carsonfb 47. carsonfb Lv 1 1 pt. 21,977
  8. Avatar for Hexafluorouranate 48. Hexafluorouranate Lv 1 1 pt. 21,887
  9. Avatar for rinze 49. rinze Lv 1 1 pt. 21,870
  10. Avatar for jamiexq 50. jamiexq Lv 1 1 pt. 21,864

Comments