Placeholder image of a protein
Icon representing a puzzle

2548: Refine Density Reconstruction 17

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary

Created
December 11, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2261, which was Reconstruction Puzzle 26, but now we have the Refine Density tool available to make folds even better! his puzzle has a couple copies of two proteins as well as peptides bound.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 22,160
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 19,983
  3. Avatar for incognito group 13. incognito group 1 pt. 12,844
  4. Avatar for Gargleblasters 14. Gargleblasters 1 pt. 12,844
  1. Avatar for pfirth 51. pfirth Lv 1 1 pt. 21,692
  2. Avatar for Mohoernchen 52. Mohoernchen Lv 1 1 pt. 21,598
  3. Avatar for maithra 53. maithra Lv 1 1 pt. 21,585
  4. Avatar for Anfinsen_slept_here 54. Anfinsen_slept_here Lv 1 1 pt. 21,476
  5. Avatar for drumpeter18yrs9yrs 55. drumpeter18yrs9yrs Lv 1 1 pt. 21,440
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 21,355
  7. Avatar for Merf 57. Merf Lv 1 1 pt. 21,336
  8. Avatar for frostschutz 58. frostschutz Lv 1 1 pt. 21,200
  9. Avatar for kholbrook5 59. kholbrook5 Lv 1 1 pt. 21,185
  10. Avatar for M1M 60. M1M Lv 1 1 pt. 21,139

Comments