Placeholder image of a protein
Icon representing a puzzle

2548: Refine Density Reconstruction 17

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 11, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2261, which was Reconstruction Puzzle 26, but now we have the Refine Density tool available to make folds even better! his puzzle has a couple copies of two proteins as well as peptides bound.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 22,160
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 19,983
  3. Avatar for incognito group 13. incognito group 1 pt. 12,844
  4. Avatar for Gargleblasters 14. Gargleblasters 1 pt. 12,844
  1. Avatar for pfirth 51. pfirth Lv 1 1 pt. 21,692
  2. Avatar for Mohoernchen 52. Mohoernchen Lv 1 1 pt. 21,598
  3. Avatar for maithra 53. maithra Lv 1 1 pt. 21,585
  4. Avatar for Anfinsen_slept_here 54. Anfinsen_slept_here Lv 1 1 pt. 21,476
  5. Avatar for drumpeter18yrs9yrs 55. drumpeter18yrs9yrs Lv 1 1 pt. 21,440
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 21,355
  7. Avatar for Merf 57. Merf Lv 1 1 pt. 21,336
  8. Avatar for frostschutz 58. frostschutz Lv 1 1 pt. 21,200
  9. Avatar for kholbrook5 59. kholbrook5 Lv 1 1 pt. 21,185
  10. Avatar for M1M 60. M1M Lv 1 1 pt. 21,139

Comments