Placeholder image of a protein
Icon representing a puzzle

2548: Refine Density Reconstruction 17

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 11, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2261, which was Reconstruction Puzzle 26, but now we have the Refine Density tool available to make folds even better! his puzzle has a couple copies of two proteins as well as peptides bound.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 23,923
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 23,688
  3. Avatar for Australia 3. Australia 44 pts. 23,337
  4. Avatar for Contenders 4. Contenders 27 pts. 23,324
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 23,307
  6. Avatar for VeFold 6. VeFold 9 pts. 23,129
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 22,995
  8. Avatar for Russian team 8. Russian team 3 pts. 22,959
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 22,844
  10. Avatar for Team China 10. Team China 1 pt. 22,242
  1. Avatar for pfirth 51. pfirth Lv 1 1 pt. 21,692
  2. Avatar for Mohoernchen 52. Mohoernchen Lv 1 1 pt. 21,598
  3. Avatar for maithra 53. maithra Lv 1 1 pt. 21,585
  4. Avatar for Anfinsen_slept_here 54. Anfinsen_slept_here Lv 1 1 pt. 21,476
  5. Avatar for drumpeter18yrs9yrs 55. drumpeter18yrs9yrs Lv 1 1 pt. 21,440
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 21,355
  7. Avatar for Merf 57. Merf Lv 1 1 pt. 21,336
  8. Avatar for frostschutz 58. frostschutz Lv 1 1 pt. 21,200
  9. Avatar for kholbrook5 59. kholbrook5 Lv 1 1 pt. 21,185
  10. Avatar for M1M 60. M1M Lv 1 1 pt. 21,139

Comments