Icon representing a puzzle

2561: Revisiting Puzzle 90: Heliomicin

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 15, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,415
  2. Avatar for METU-BIN 12. METU-BIN 1 pt. 8,375
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 7,729

  1. Avatar for NiceNonnaphat 51. NiceNonnaphat Lv 1 1 pt. 8,573
  2. Avatar for RWoodcock 52. RWoodcock Lv 1 1 pt. 8,527
  3. Avatar for zbp 53. zbp Lv 1 1 pt. 8,483
  4. Avatar for t0n1 54. t0n1 Lv 1 1 pt. 8,449
  5. Avatar for Ikuso 55. Ikuso Lv 1 1 pt. 8,415
  6. Avatar for rinze 56. rinze Lv 1 1 pt. 8,415
  7. Avatar for Trajan464 57. Trajan464 Lv 1 1 pt. 8,394
  8. Avatar for alevbozan 58. alevbozan Lv 1 1 pt. 8,375
  9. Avatar for DScott 59. DScott Lv 1 1 pt. 8,307
  10. Avatar for Nazli Cakir 60. Nazli Cakir Lv 1 1 pt. 8,221

Comments