Icon representing a puzzle

2561: Revisiting Puzzle 90: Heliomicin

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 15, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,850
  2. Avatar for Go Science 2. Go Science 65 pts. 9,808
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 9,709
  4. Avatar for Contenders 4. Contenders 24 pts. 9,658
  5. Avatar for Australia 5. Australia 14 pts. 9,657
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 9,612
  7. Avatar for VeFold 7. VeFold 4 pts. 9,585
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 9,571
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,546
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,501
  1. Avatar for NiceNonnaphat 51. NiceNonnaphat Lv 1 1 pt. 8,573
  2. Avatar for RWoodcock 52. RWoodcock Lv 1 1 pt. 8,527
  3. Avatar for zbp 53. zbp Lv 1 1 pt. 8,483
  4. Avatar for t0n1 54. t0n1 Lv 1 1 pt. 8,449
  5. Avatar for Ikuso 55. Ikuso Lv 1 1 pt. 8,415
  6. Avatar for rinze 56. rinze Lv 1 1 pt. 8,415
  7. Avatar for Trajan464 57. Trajan464 Lv 1 1 pt. 8,394
  8. Avatar for alevbozan 58. alevbozan Lv 1 1 pt. 8,375
  9. Avatar for DScott 59. DScott Lv 1 1 pt. 8,307
  10. Avatar for Nazli Cakir 60. Nazli Cakir Lv 1 1 pt. 8,221

Comments