Icon representing a puzzle

2565: Revisiting Puzzle 91: Virus Protein

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,566
  2. Avatar for Marvin's bunch 2. Marvin's bunch 65 pts. 10,488
  3. Avatar for Go Science 3. Go Science 41 pts. 10,413
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 24 pts. 10,339
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,338
  6. Avatar for Contenders 6. Contenders 7 pts. 10,309
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 10,072
  8. Avatar for Australia 8. Australia 2 pts. 9,986
  9. Avatar for VeFold 9. VeFold 1 pt. 9,894
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,211
  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 45 pts. 10,244
  2. Avatar for Galaxie 12. Galaxie Lv 1 41 pts. 10,233
  3. Avatar for gmn 13. gmn Lv 1 38 pts. 10,216
  4. Avatar for g_b 14. g_b Lv 1 35 pts. 10,198
  5. Avatar for Bletchley Park 15. Bletchley Park Lv 1 31 pts. 10,195
  6. Avatar for georg137 16. georg137 Lv 1 29 pts. 10,083
  7. Avatar for TheGUmmer 17. TheGUmmer Lv 1 26 pts. 10,072
  8. Avatar for manu8170 18. manu8170 Lv 1 24 pts. 10,070
  9. Avatar for Punzi Baker 3 19. Punzi Baker 3 Lv 1 21 pts. 10,027
  10. Avatar for AlkiP0Ps 20. AlkiP0Ps Lv 1 19 pts. 9,986

Comments