Icon representing a puzzle

2565: Revisiting Puzzle 91: Virus Protein

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,566
  2. Avatar for Marvin's bunch 2. Marvin's bunch 65 pts. 10,488
  3. Avatar for Go Science 3. Go Science 41 pts. 10,413
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 24 pts. 10,339
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,338
  6. Avatar for Contenders 6. Contenders 7 pts. 10,309
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 10,072
  8. Avatar for Australia 8. Australia 2 pts. 9,986
  9. Avatar for VeFold 9. VeFold 1 pt. 9,894
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,211

  1. Avatar for Dr.Sillem 51. Dr.Sillem Lv 1 1 pt. 8,744
  2. Avatar for rinze 52. rinze Lv 1 1 pt. 8,716
  3. Avatar for kitsoune 53. kitsoune Lv 1 1 pt. 8,700
  4. Avatar for vybi 54. vybi Lv 1 1 pt. 8,673
  5. Avatar for zo3xiaJonWeinberg 55. zo3xiaJonWeinberg Lv 1 1 pt. 8,649
  6. Avatar for Larini 56. Larini Lv 1 1 pt. 8,619
  7. Avatar for Merf 57. Merf Lv 1 1 pt. 8,480
  8. Avatar for efull 58. efull Lv 1 1 pt. 8,148
  9. Avatar for Swapper242 59. Swapper242 Lv 1 1 pt. 8,124
  10. Avatar for glaminator 60. glaminator Lv 1 1 pt. 8,059

Comments