Icon representing a puzzle

2565: Revisiting Puzzle 91: Virus Protein

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,566
  2. Avatar for Marvin's bunch 2. Marvin's bunch 65 pts. 10,488
  3. Avatar for Go Science 3. Go Science 41 pts. 10,413
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 24 pts. 10,339
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,338
  6. Avatar for Contenders 6. Contenders 7 pts. 10,309
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 10,072
  8. Avatar for Australia 8. Australia 2 pts. 9,986
  9. Avatar for VeFold 9. VeFold 1 pt. 9,894
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,211
  1. Avatar for pfirth 31. pfirth Lv 1 6 pts. 9,653
  2. Avatar for ProfVince 32. ProfVince Lv 1 5 pts. 9,487
  3. Avatar for Hellcat6 33. Hellcat6 Lv 1 4 pts. 9,453
  4. Avatar for blazegeek 34. blazegeek Lv 1 4 pts. 9,386
  5. Avatar for alcor29 35. alcor29 Lv 1 3 pts. 9,381
  6. Avatar for carsonfb 36. carsonfb Lv 1 3 pts. 9,235
  7. Avatar for SaraL 37. SaraL Lv 1 3 pts. 9,211
  8. Avatar for melonogaster 38. melonogaster Lv 1 2 pts. 9,199
  9. Avatar for carxo 39. carxo Lv 1 2 pts. 9,105
  10. Avatar for Simek 40. Simek Lv 1 2 pts. 9,089

Comments