Icon representing a puzzle

2565: Revisiting Puzzle 91: Virus Protein

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,566
  2. Avatar for Marvin's bunch 2. Marvin's bunch 65 pts. 10,488
  3. Avatar for Go Science 3. Go Science 41 pts. 10,413
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 24 pts. 10,339
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,338
  6. Avatar for Contenders 6. Contenders 7 pts. 10,309
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 10,072
  8. Avatar for Australia 8. Australia 2 pts. 9,986
  9. Avatar for VeFold 9. VeFold 1 pt. 9,894
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,211
  1. Avatar for nicobul 21. nicobul Lv 1 17 pts. 9,938
  2. Avatar for jamiexq 22. jamiexq Lv 1 16 pts. 9,932
  3. Avatar for akaaka 23. akaaka Lv 1 14 pts. 9,931
  4. Avatar for Anfinsen_slept_here 24. Anfinsen_slept_here Lv 1 13 pts. 9,922
  5. Avatar for toshiue 25. toshiue Lv 1 11 pts. 9,899
  6. Avatar for hookedwarm 26. hookedwarm Lv 1 10 pts. 9,894
  7. Avatar for NPrincipi 27. NPrincipi Lv 1 9 pts. 9,849
  8. Avatar for JuliaBCollet 28. JuliaBCollet Lv 1 8 pts. 9,765
  9. Avatar for BarrySampson 29. BarrySampson Lv 1 7 pts. 9,733
  10. Avatar for Crossed Sticks 30. Crossed Sticks Lv 1 6 pts. 9,732

Comments