2569: Revisiting Puzzle 93: Spider Toxin

Closed since about 1 year ago

Summary

• Created: February 05, 2025
• Expires: February 12, 2025 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

• Sequence: KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

• 1. Anthropic Dreams 100 pts. 10,012
• 2. Go Science 65 pts. 9,963
• 3. VeFold 41 pts. 9,890
• 4. Marvin's bunch 24 pts. 9,887
• 5. Contenders 14 pts. 9,881
• 6. L'Alliance Francophone 7 pts. 9,742
• 7. Void Crushers 4 pts. 9,726
• 8. Australia 2 pts. 9,695
• 9. FamilyBarmettler 1 pt. 9,662
• 10. Kotocycle 1 pt. 9,293

Top soloists

• 11. Bruno Kestemont 56 pts. 9,833
• 12. dcrwheeler 53 pts. 9,824
• 13. hookedwarm 49 pts. 9,805
• 14. Punzi Baker 3 46 pts. 9,801
• 15. gmn 43 pts. 9,767
• 16. g_b 41 pts. 9,754
• 17. christioanchauvin 38 pts. 9,742
• 18. jamiexq 36 pts. 9,741
• 19. TheGUmmer 33 pts. 9,726
• 20. Crossed Sticks 31 pts. 9,718

Comments

[WBarme1234]

Again a wrong puzzle number - double used 2565!

[LociOiling]

in the grasp of the grass spider: https://foldit.fandom.com/wiki/Revisiting_puzzle/93:_Spider_Toxin

[beta_helix]

Sorry, we had a server hiccup last week and we thought we had addressed all the issues stemming from it