2569: Revisiting Puzzle 93: Spider Toxin

Closed since about 1 year ago

Summary

• Created: February 05, 2025
• Expires: February 12, 2025 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

• Sequence: KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

• 1. Anthropic Dreams 100 pts. 10,012
• 2. Go Science 65 pts. 9,963
• 3. VeFold 41 pts. 9,890
• 4. Marvin's bunch 24 pts. 9,887
• 5. Contenders 14 pts. 9,881
• 6. L'Alliance Francophone 7 pts. 9,742
• 7. Void Crushers 4 pts. 9,726
• 8. Australia 2 pts. 9,695
• 9. FamilyBarmettler 1 pt. 9,662
• 10. Kotocycle 1 pt. 9,293

Top soloists

• 21. AlkiP0Ps 29 pts. 9,695
• 22. BootsMcGraw 27 pts. 9,671
• 23. Aubade01 25 pts. 9,670
• 24. WBarme1234 23 pts. 9,662
• 25. BarrySampson 22 pts. 9,574
• 26. JuliaBCollet 20 pts. 9,498
• 27. pfirth 19 pts. 9,488
• 28. nicobul 17 pts. 9,459
• 29. alcor29 16 pts. 9,456
• 30. Anfinsen_slept_here 15 pts. 9,377

Comments

[WBarme1234]

Again a wrong puzzle number - double used 2565!

[LociOiling]

in the grasp of the grass spider: https://foldit.fandom.com/wiki/Revisiting_puzzle/93:_Spider_Toxin

[beta_helix]

Sorry, we had a server hiccup last week and we thought we had addressed all the issues stemming from it