Icon representing a puzzle

2595: Revisiting Puzzle 113: White Birch

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
April 09, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 9,093
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 8,815
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 5,520
  4. Avatar for Boilermakers 14. Boilermakers 1 pt. 5,520
  1. Avatar for alcor29 11. alcor29 Lv 1 52 pts. 10,734
  2. Avatar for TheGUmmer 12. TheGUmmer Lv 1 49 pts. 10,730
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 45 pts. 10,704
  4. Avatar for BarrySampson 14. BarrySampson Lv 1 42 pts. 10,700
  5. Avatar for akaaka 15. akaaka Lv 1 39 pts. 10,682
  6. Avatar for orily1337 16. orily1337 Lv 1 36 pts. 10,643
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 34 pts. 10,642
  8. Avatar for grogar7 18. grogar7 Lv 1 31 pts. 10,640
  9. Avatar for AlkiP0Ps 19. AlkiP0Ps Lv 1 29 pts. 10,621
  10. Avatar for Aubade01 20. Aubade01 Lv 1 27 pts. 10,612

Comments