Icon representing a puzzle

2595: Revisiting Puzzle 113: White Birch

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
April 09, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 9,093
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 8,815
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 5,520
  4. Avatar for Boilermakers 14. Boilermakers 1 pt. 5,520
  1. Avatar for AlphaFold2 21. AlphaFold2 Lv 1 25 pts. 10,591
  2. Avatar for jausmh 22. jausmh Lv 1 23 pts. 10,587
  3. Avatar for nicobul 23. nicobul Lv 1 21 pts. 10,587
  4. Avatar for meatexplosion 24. meatexplosion Lv 1 19 pts. 10,576
  5. Avatar for LHOr 25. LHOr Lv 1 18 pts. 10,573
  6. Avatar for drumpeter18yrs9yrs 26. drumpeter18yrs9yrs Lv 1 16 pts. 10,561
  7. Avatar for amakedon 27. amakedon Lv 1 15 pts. 10,551
  8. Avatar for gmn 28. gmn Lv 1 14 pts. 10,542
  9. Avatar for jamiexq 29. jamiexq Lv 1 12 pts. 10,520
  10. Avatar for JuliaBCollet 30. JuliaBCollet Lv 1 11 pts. 10,497

Comments