Icon representing a puzzle

2598: Revisiting Puzzle 114: Black Mamba

Closed since 12 months ago

Novice Overall Prediction

Summary

Created
April 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for CHEM1210/1020 TTU 11. CHEM1210/1020 TTU 1 pt. 9,152
  2. Avatar for OmHS 12. OmHS 1 pt. 6,348
  3. Avatar for Intellectual decay of Brazil (IDEB) 13. Intellectual decay of Brazil (IDEB) 1 pt. 6,348
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,348
  1. Avatar for jausmh 11. jausmh Lv 1 50 pts. 11,110
  2. Avatar for akaaka 12. akaaka Lv 1 47 pts. 11,109
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 43 pts. 11,105
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 40 pts. 11,103
  5. Avatar for meatexplosion 15. meatexplosion Lv 1 37 pts. 11,098
  6. Avatar for nicobul 16. nicobul Lv 1 34 pts. 11,097
  7. Avatar for WBarme1234 17. WBarme1234 Lv 1 32 pts. 11,075
  8. Avatar for Punzi Baker 3 18. Punzi Baker 3 Lv 1 29 pts. 11,056
  9. Avatar for BootsMcGraw 19. BootsMcGraw Lv 1 27 pts. 11,046
  10. Avatar for orily1337 20. orily1337 Lv 1 25 pts. 11,034

Comments