Icon representing a puzzle

2598: Revisiting Puzzle 114: Black Mamba

Closed since 12 months ago

Novice Overall Prediction

Summary

Created
April 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for CHEM1210/1020 TTU 11. CHEM1210/1020 TTU 1 pt. 9,152
  2. Avatar for OmHS 12. OmHS 1 pt. 6,348
  3. Avatar for Intellectual decay of Brazil (IDEB) 13. Intellectual decay of Brazil (IDEB) 1 pt. 6,348
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,348
  1. Avatar for CAN1958 41. CAN1958 Lv 1 3 pts. 10,079
  2. Avatar for pizpot 42. pizpot Lv 1 3 pts. 9,891
  3. Avatar for kitsoune 43. kitsoune Lv 1 2 pts. 9,855
  4. Avatar for DH160 44. DH160 Lv 1 2 pts. 9,841
  5. Avatar for Osiris 45. Osiris Lv 1 2 pts. 9,785
  6. Avatar for prkfour 46. prkfour Lv 1 2 pts. 9,775
  7. Avatar for LHOr 47. LHOr Lv 1 2 pts. 9,769
  8. Avatar for Trajan464 48. Trajan464 Lv 1 1 pt. 9,730
  9. Avatar for carxo 49. carxo Lv 1 1 pt. 9,718
  10. Avatar for Vinara 50. Vinara Lv 1 1 pt. 9,717

Comments