Icon representing a puzzle

2638: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since 8 months ago

Novice Overall Prediction

Summary


Created
July 23, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,182
  2. Avatar for Go Science 2. Go Science 68 pts. 12,167
  3. Avatar for Contenders 3. Contenders 44 pts. 12,044
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 11,984
  5. Avatar for Australia 5. Australia 16 pts. 11,952
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 11,865
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 11,823
  8. Avatar for VeFold 8. VeFold 3 pts. 11,800
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 11,790
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 11,404

  1. Avatar for Anfinsen_slept_here 31. Anfinsen_slept_here Lv 1 9 pts. 11,624
  2. Avatar for alcor29 32. alcor29 Lv 1 8 pts. 11,605
  3. Avatar for BarrySampson 33. BarrySampson Lv 1 8 pts. 11,585
  4. Avatar for jamiexq 34. jamiexq Lv 1 7 pts. 11,555
  5. Avatar for ProfVince 35. ProfVince Lv 1 6 pts. 11,550
  6. Avatar for hansvandenhof 36. hansvandenhof Lv 1 6 pts. 11,540
  7. Avatar for Alistair69 37. Alistair69 Lv 1 5 pts. 11,487
  8. Avatar for vuvuvu 38. vuvuvu Lv 1 5 pts. 11,404
  9. Avatar for ppp6 39. ppp6 Lv 1 4 pts. 11,380
  10. Avatar for Oscar JV 40. Oscar JV Lv 1 4 pts. 11,347

Comments