Icon representing a puzzle

2638: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since 8 months ago

Novice Overall Prediction

Summary

Created
July 23, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,182
  2. Avatar for Go Science 2. Go Science 68 pts. 12,167
  3. Avatar for Contenders 3. Contenders 44 pts. 12,044
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 11,984
  5. Avatar for Australia 5. Australia 16 pts. 11,952
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 11,865
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 11,823
  8. Avatar for VeFold 8. VeFold 3 pts. 11,800
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 11,790
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 11,404
  1. Avatar for BlueCat74 51. BlueCat74 Lv 1 1 pt. 10,977
  2. Avatar for Merf 52. Merf Lv 1 1 pt. 10,943
  3. Avatar for carxo 53. carxo Lv 1 1 pt. 10,941
  4. Avatar for Penguin1 54. Penguin1 Lv 1 1 pt. 10,924
  5. Avatar for skyleriscool 55. skyleriscool Lv 1 1 pt. 10,915
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 10,907
  7. Avatar for Pietro 57. Pietro Lv 1 1 pt. 10,836
  8. Avatar for rinze 58. rinze Lv 1 1 pt. 10,800
  9. Avatar for Mohoernchen 59. Mohoernchen Lv 1 1 pt. 10,780
  10. Avatar for Savas 60. Savas Lv 1 1 pt. 10,771

Comments