Icon representing a puzzle

2659: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
September 10, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,011
  2. Avatar for Go Science 2. Go Science 68 pts. 11,937
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 11,561
  4. Avatar for Team China 4. Team China 27 pts. 11,522
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 11,444
  6. Avatar for Contenders 6. Contenders 9 pts. 11,391
  7. Avatar for VeFold 7. VeFold 5 pts. 11,311
  8. Avatar for Australia 8. Australia 3 pts. 11,274
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 11,208
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 11,102
  1. Avatar for meatexplosion 11. meatexplosion Lv 1 50 pts. 11,537
  2. Avatar for Zhang Ruichong 12. Zhang Ruichong Lv 1 46 pts. 11,522
  3. Avatar for g_b 13. g_b Lv 1 43 pts. 11,480
  4. Avatar for Dr. Goochie 14. Dr. Goochie Lv 1 40 pts. 11,463
  5. Avatar for NinjaGreg 15. NinjaGreg Lv 1 37 pts. 11,459
  6. Avatar for dcrwheeler 16. dcrwheeler Lv 1 34 pts. 11,451
  7. Avatar for akaaka 17. akaaka Lv 1 31 pts. 11,446
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 29 pts. 11,444
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 26 pts. 11,435
  10. Avatar for BootsMcGraw 20. BootsMcGraw Lv 1 24 pts. 11,391

Comments