Icon representing a puzzle

2659: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
September 10, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,011
  2. Avatar for Go Science 2. Go Science 68 pts. 11,937
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 11,561
  4. Avatar for Team China 4. Team China 27 pts. 11,522
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 11,444
  6. Avatar for Contenders 6. Contenders 9 pts. 11,391
  7. Avatar for VeFold 7. VeFold 5 pts. 11,311
  8. Avatar for Australia 8. Australia 3 pts. 11,274
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 11,208
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 11,102
  1. Avatar for hada 41. hada Lv 1 3 pts. 10,720
  2. Avatar for Alistair69 42. Alistair69 Lv 1 3 pts. 10,698
  3. Avatar for pfirth 43. pfirth Lv 1 2 pts. 10,670
  4. Avatar for Apothecary1815 44. Apothecary1815 Lv 1 2 pts. 10,641
  5. Avatar for jamiexq 45. jamiexq Lv 1 2 pts. 10,638
  6. Avatar for chrisb41 46. chrisb41 Lv 1 2 pts. 10,596
  7. Avatar for Larini 47. Larini Lv 1 1 pt. 10,595
  8. Avatar for Trajan464 48. Trajan464 Lv 1 1 pt. 10,551
  9. Avatar for Fasodankfds 49. Fasodankfds Lv 1 1 pt. 10,540
  10. Avatar for abiogenesis 50. abiogenesis Lv 1 1 pt. 10,534

Comments