Icon representing a puzzle

2659: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
September 10, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,011
  2. Avatar for Go Science 2. Go Science 68 pts. 11,937
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 11,561
  4. Avatar for Team China 4. Team China 27 pts. 11,522
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 11,444
  6. Avatar for Contenders 6. Contenders 9 pts. 11,391
  7. Avatar for VeFold 7. VeFold 5 pts. 11,311
  8. Avatar for Australia 8. Australia 3 pts. 11,274
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 11,208
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 11,102
  1. Avatar for zbp 51. zbp Lv 1 1 pt. 10,473
  2. Avatar for haleyg 52. haleyg Lv 1 1 pt. 10,473
  3. Avatar for carxo 53. carxo Lv 1 1 pt. 10,439
  4. Avatar for fikret 54. fikret Lv 1 1 pt. 10,407
  5. Avatar for DScott 55. DScott Lv 1 1 pt. 10,166
  6. Avatar for Hellcat6 56. Hellcat6 Lv 1 1 pt. 10,111
  7. Avatar for Mohoernchen 57. Mohoernchen Lv 1 1 pt. 9,966
  8. Avatar for Merf 58. Merf Lv 1 1 pt. 9,903
  9. Avatar for rinze 59. rinze Lv 1 1 pt. 9,855
  10. Avatar for Sharmal 60. Sharmal Lv 1 1 pt. 9,853

Comments