Icon representing a puzzle

2659: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
September 10, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,011
  2. Avatar for Go Science 2. Go Science 68 pts. 11,937
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 11,561
  4. Avatar for Team China 4. Team China 27 pts. 11,522
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 11,444
  6. Avatar for Contenders 6. Contenders 9 pts. 11,391
  7. Avatar for VeFold 7. VeFold 5 pts. 11,311
  8. Avatar for Australia 8. Australia 3 pts. 11,274
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 11,208
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 11,102
  1. Avatar for drumpeter18yrs9yrs 61. drumpeter18yrs9yrs Lv 1 1 pt. 9,815
  2. Avatar for efull 62. efull Lv 1 1 pt. 9,781
  3. Avatar for AlphaSTEEL06 63. AlphaSTEEL06 Lv 1 1 pt. 9,756
  4. Avatar for Tenlocket 64. Tenlocket Lv 1 1 pt. 9,629
  5. Avatar for Tehnologik1 65. Tehnologik1 Lv 1 1 pt. 9,608
  6. Avatar for AlphaFold2 66. AlphaFold2 Lv 1 1 pt. 9,593
  7. Avatar for JellyfishOliPlays 67. JellyfishOliPlays Lv 1 1 pt. 9,195
  8. Avatar for vvvnnn 68. vvvnnn Lv 1 1 pt. 8,932
  9. Avatar for NicoleS1017 69. NicoleS1017 Lv 1 1 pt. 8,400
  10. Avatar for hayoo3359 70. hayoo3359 Lv 1 1 pt. 8,336

Comments