Icon representing a puzzle

2671: Revisiting Puzzle 52: Bacteria Energy

Closed since 5 months ago

Novice Overall Prediction

Summary

Created
October 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,687
  2. Avatar for Go Science 2. Go Science 70 pts. 11,647
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 47 pts. 11,579
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 11,418
  5. Avatar for Void Crushers 5. Void Crushers 19 pts. 11,339
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 11,333
  7. Avatar for Contenders 7. Contenders 7 pts. 11,282
  8. Avatar for Australia 8. Australia 4 pts. 11,269
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,046
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 10,974
  1. Avatar for nicobul 11. nicobul Lv 1 52 pts. 11,385
  2. Avatar for Galaxie 12. Galaxie Lv 1 49 pts. 11,360
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 45 pts. 11,350
  4. Avatar for TheGUmmer 14. TheGUmmer Lv 1 42 pts. 11,339
  5. Avatar for dizzywings 15. dizzywings Lv 1 39 pts. 11,333
  6. Avatar for Bruno Kestemont 16. Bruno Kestemont Lv 1 36 pts. 11,332
  7. Avatar for Aarav_Awasthi 17. Aarav_Awasthi Lv 1 34 pts. 11,307
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 31 pts. 11,282
  9. Avatar for AlkiP0Ps 19. AlkiP0Ps Lv 1 29 pts. 11,269
  10. Avatar for dcrwheeler 20. dcrwheeler Lv 1 27 pts. 11,258

Comments