Icon representing a puzzle

2689: Revisiting Puzzle 60: Beta Barrel

Closed since 4 months ago

Novice Overall Prediction

Summary

Created
November 19, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,846
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 12,790
  3. Avatar for VeFold 3. VeFold 41 pts. 12,633
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 24 pts. 12,470
  5. Avatar for Australia 5. Australia 14 pts. 12,468
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 12,466
  7. Avatar for Contenders 7. Contenders 4 pts. 12,332
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 12,294
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 11,781
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 11,056
  1. Avatar for Floddi 31. Floddi Lv 1 10 pts. 12,053
  2. Avatar for BarrySampson 32. BarrySampson Lv 1 9 pts. 12,051
  3. Avatar for ucad 33. ucad Lv 1 9 pts. 12,023
  4. Avatar for latin krepin 34. latin krepin Lv 1 8 pts. 12,015
  5. Avatar for Moolanie 35. Moolanie Lv 1 7 pts. 11,964
  6. Avatar for akonin28 36. akonin28 Lv 1 6 pts. 11,959
  7. Avatar for zxspectrum 37. zxspectrum Lv 1 6 pts. 11,958
  8. Avatar for Apothecary1815 38. Apothecary1815 Lv 1 5 pts. 11,923
  9. Avatar for Aarav_Awasthi 39. Aarav_Awasthi Lv 1 5 pts. 11,905
  10. Avatar for vybi 40. vybi Lv 1 4 pts. 11,871

Comments