Icon representing a puzzle

2689: Revisiting Puzzle 60: Beta Barrel

Closed since 4 months ago

Novice Overall Prediction

Summary

Created
November 19, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,846
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 12,790
  3. Avatar for VeFold 3. VeFold 41 pts. 12,633
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 24 pts. 12,470
  5. Avatar for Australia 5. Australia 14 pts. 12,468
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 12,466
  7. Avatar for Contenders 7. Contenders 4 pts. 12,332
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 12,294
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 11,781
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 11,056
  1. Avatar for manu8170 41. manu8170 Lv 1 4 pts. 11,858
  2. Avatar for Trajan464 42. Trajan464 Lv 1 3 pts. 11,783
  3. Avatar for Joanna_H 43. Joanna_H Lv 1 3 pts. 11,781
  4. Avatar for BURGS69 44. BURGS69 Lv 1 3 pts. 11,773
  5. Avatar for heather-1 45. heather-1 Lv 1 2 pts. 11,766
  6. Avatar for knowclue 46. knowclue Lv 1 2 pts. 11,765
  7. Avatar for Dr.Sillem 47. Dr.Sillem Lv 1 2 pts. 11,751
  8. Avatar for Idiotboy 48. Idiotboy Lv 1 2 pts. 11,750
  9. Avatar for abiogenesis 49. abiogenesis Lv 1 2 pts. 11,686
  10. Avatar for carxo 50. carxo Lv 1 1 pt. 11,673

Comments