Icon representing a puzzle

2689: Revisiting Puzzle 60: Beta Barrel

Closed since 4 months ago

Novice Overall Prediction

Summary

Created
November 19, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,846
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 12,790
  3. Avatar for VeFold 3. VeFold 41 pts. 12,633
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 24 pts. 12,470
  5. Avatar for Australia 5. Australia 14 pts. 12,468
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 12,466
  7. Avatar for Contenders 7. Contenders 4 pts. 12,332
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 12,294
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 11,781
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 11,056
  1. Avatar for nicobul 21. nicobul Lv 1 25 pts. 12,289
  2. Avatar for georg137 22. georg137 Lv 1 23 pts. 12,211
  3. Avatar for alcor29 23. alcor29 Lv 1 21 pts. 12,207
  4. Avatar for g_b 24. g_b Lv 1 19 pts. 12,173
  5. Avatar for Bletchley Park 25. Bletchley Park Lv 1 18 pts. 12,170
  6. Avatar for Elfi 26. Elfi Lv 1 16 pts. 12,150
  7. Avatar for Galaxie 27. Galaxie Lv 1 15 pts. 12,145
  8. Avatar for NinjaGreg 28. NinjaGreg Lv 1 14 pts. 12,132
  9. Avatar for carsonfb 29. carsonfb Lv 1 12 pts. 12,056
  10. Avatar for majyunyan 30. majyunyan Lv 1 11 pts. 12,056

Comments