Icon representing a puzzle

2689: Revisiting Puzzle 60: Beta Barrel

Closed since 4 months ago

Novice Overall Prediction

Summary

Created
November 19, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,846
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 12,790
  3. Avatar for VeFold 3. VeFold 41 pts. 12,633
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 24 pts. 12,470
  5. Avatar for Australia 5. Australia 14 pts. 12,468
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 12,466
  7. Avatar for Contenders 7. Contenders 4 pts. 12,332
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 12,294
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 11,781
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 11,056
  1. Avatar for DScott 71. DScott Lv 1 1 pt. 11,038
  2. Avatar for efull 72. efull Lv 1 1 pt. 10,954
  3. Avatar for Jenot96 73. Jenot96 Lv 1 1 pt. 10,877
  4. Avatar for froschi2 74. froschi2 Lv 1 1 pt. 10,868
  5. Avatar for RWoodcock 75. RWoodcock Lv 1 1 pt. 10,820
  6. Avatar for Swapper242 76. Swapper242 Lv 1 1 pt. 10,753
  7. Avatar for Russbear 77. Russbear Lv 1 1 pt. 10,697
  8. Avatar for Mahdi 78. Mahdi Lv 1 1 pt. 10,691
  9. Avatar for Slug 79. Slug Lv 1 1 pt. 10,552
  10. Avatar for kumatxra 80. kumatxra Lv 1 1 pt. 10,457

Comments