Icon representing a puzzle

2689: Revisiting Puzzle 60: Beta Barrel

Closed since 6 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 19, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Go Science 100 pts. 12,846
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 12,790
  3. Avatar for VeFold 3. VeFold 41 pts. 12,633
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 24 pts. 12,470
  5. Avatar for Australia 5. Australia 14 pts. 12,468
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 12,466
  7. Avatar for Contenders 7. Contenders 4 pts. 12,332
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 12,294
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 11,781
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 11,056

  1. Avatar for silent gene 61. silent gene Lv 1 1 pt. 11,329
  2. Avatar for jamiexq 62. jamiexq Lv 1 1 pt. 11,285
  3. Avatar for mammillaria 63. mammillaria Lv 1 1 pt. 11,247
  4. Avatar for Fasodankfds 64. Fasodankfds Lv 1 1 pt. 11,208
  5. Avatar for rinze 65. rinze Lv 1 1 pt. 11,165
  6. Avatar for prkfour 66. prkfour Lv 1 1 pt. 11,146
  7. Avatar for Mohoernchen 67. Mohoernchen Lv 1 1 pt. 11,098
  8. Avatar for p.naka 68. p.naka Lv 1 1 pt. 11,080
  9. Avatar for Matrena 69. Matrena Lv 1 1 pt. 11,070
  10. Avatar for Savas 70. Savas Lv 1 1 pt. 11,056

Comments