Icon representing a puzzle

2701: Revisiting Puzzle 64: Thioredoxin

Closed since 3 months ago

Novice Overall Prediction

Summary

Created
December 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 11,333
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 11,188
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,861
  4. Avatar for Mahmut Oyunda 14. Mahmut Oyunda 1 pt. 10,846
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 10,807
  6. Avatar for Team China 16. Team China 1 pt. 10,785
  1. Avatar for Xendrais 11. Xendrais Lv 1 51 pts. 11,681
  2. Avatar for Dr. Goochie 12. Dr. Goochie Lv 1 48 pts. 11,665
  3. Avatar for BarrySampson 13. BarrySampson Lv 1 44 pts. 11,654
  4. Avatar for Dr.Sillem 14. Dr.Sillem Lv 1 41 pts. 11,649
  5. Avatar for gmn 15. gmn Lv 1 38 pts. 11,645
  6. Avatar for Aarav_Awasthi 16. Aarav_Awasthi Lv 1 35 pts. 11,643
  7. Avatar for AlkiP0Ps 17. AlkiP0Ps Lv 1 33 pts. 11,639
  8. Avatar for bravosk8erboy 18. bravosk8erboy Lv 1 30 pts. 11,636
  9. Avatar for georg137 19. georg137 Lv 1 28 pts. 11,635
  10. Avatar for dpmattingly 20. dpmattingly Lv 1 26 pts. 11,634

Comments