Icon representing a puzzle

2701: Revisiting Puzzle 64: Thioredoxin

Closed since 6 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,826
  2. Avatar for Go Science 2. Go Science 71 pts. 11,778
  3. Avatar for VeFold 3. VeFold 49 pts. 11,742
  4. Avatar for Contenders 4. Contenders 33 pts. 11,685
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,683
  6. Avatar for Australia 6. Australia 14 pts. 11,639
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 8 pts. 11,625
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 11,543
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 11,471
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 11,460

  1. Avatar for Xendrais 11. Xendrais Lv 1 51 pts. 11,681
  2. Avatar for Dr. Goochie 12. Dr. Goochie Lv 1 48 pts. 11,665
  3. Avatar for BarrySampson 13. BarrySampson Lv 1 44 pts. 11,654
  4. Avatar for Dr.Sillem 14. Dr.Sillem Lv 1 41 pts. 11,649
  5. Avatar for gmn 15. gmn Lv 1 38 pts. 11,645
  6. Avatar for Aarav_Awasthi 16. Aarav_Awasthi Lv 1 35 pts. 11,643
  7. Avatar for AlkiP0Ps 17. AlkiP0Ps Lv 1 33 pts. 11,639
  8. Avatar for bravosk8erboy 18. bravosk8erboy Lv 1 30 pts. 11,636
  9. Avatar for georg137 19. georg137 Lv 1 28 pts. 11,635
  10. Avatar for dpmattingly 20. dpmattingly Lv 1 26 pts. 11,634

Comments