Icon representing a puzzle

2701: Revisiting Puzzle 64: Thioredoxin

Closed since 3 months ago

Novice Overall Prediction

Summary

Created
December 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 11,333
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 11,188
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,861
  4. Avatar for Mahmut Oyunda 14. Mahmut Oyunda 1 pt. 10,846
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 10,807
  6. Avatar for Team China 16. Team China 1 pt. 10,785
  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 24 pts. 11,625
  2. Avatar for christioanchauvin 22. christioanchauvin Lv 1 22 pts. 11,621
  3. Avatar for Elfi 23. Elfi Lv 1 20 pts. 11,620
  4. Avatar for westchuck 24. westchuck Lv 1 18 pts. 11,607
  5. Avatar for g_b 25. g_b Lv 1 17 pts. 11,603
  6. Avatar for NinjaGreg 26. NinjaGreg Lv 1 15 pts. 11,583
  7. Avatar for zxspectrum 27. zxspectrum Lv 1 14 pts. 11,569
  8. Avatar for ichwilldiesennamen 28. ichwilldiesennamen Lv 1 13 pts. 11,563
  9. Avatar for AlphaFold2 29. AlphaFold2 Lv 1 12 pts. 11,560
  10. Avatar for TheGUmmer 30. TheGUmmer Lv 1 11 pts. 11,543

Comments